General Information

  • ID:  hor005794
  • Uniprot ID:  P20068
  • Protein name:  Tail peptide
  • Gene name:  Nts
  • Organism:  Rattus norvegicus (Rat)
  • Family:  Neurotensin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005184 neuropeptide hormone activity; GO:0048018 receptor ligand activity; GO:0071855 neuropeptide receptor binding
  • GO BP:  GO:0001889 liver development; GO:0001975 response to amphetamine; GO:0006972 hyperosmotic response; GO:0007218 neuropeptide signaling pathway; GO:0008542 visual learning; GO:0010628 positive regulation of gene expression; GO:0010629 negative regulation of gene expression; GO:0032355 response to estradiol; GO:0042220 response to cocaine; GO:0048565 digestive tract development; GO:0048678 response to axon injury; GO:0051385 response to mineralocorticoid; GO:0051412 response to corticosterone; GO:0051897 positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction; GO:0071285 cellular response to lithium ion; GO:0071549 cellular response to dexamethasone stimulus; GO:0097332 response to antipsychotic drug; GO:0097746 blood vessel diameter maintenance; GO:1990090 cellular response to nerve growth factor stimulus
  • GO CC:  GO:0005576 extracellular region; GO:0030133 transport vesicle; GO:0031410 cytoplasmic vesicle; GO:0043025 neuronal cell body; GO:0043679 axon terminus

Sequence Information

  • Sequence:  ASYYY
  • Length:  5(165-169)
  • Propeptide:  MIGMNLQLVCLTLLAFSSWSLCSDSEEDVRALEADLLTNMHASKVSKGSPPSWKMTLLNVCSLINNLNSAAEEAGEMRDDDLVAKRKLPLVLDDFSLEALLTVFQLQKICRSRAFQHWEIIQEDILDHGNEKTEKEEVIKRKIPYILKRQLYENKPRRPYILKRASYYY
  • Signal peptide:  MIGMNLQLVCLTLLAFSSWSLC
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Neurotensin may play an endocrine or paracrine role in the regulation of fat metabolism. It causes contraction of smooth muscle.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  Ntsr1
  • Target Unid:   P20789
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P20068-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005794_AF2.pdbhor005794_ESM.pdb

Physical Information

Mass: 73722 Formula: C33H39N5O10
Absent amino acids: CDEFGHIKLMNPQRTVW Common amino acids: Y
pI: 6.08 Basic residues: 0
Polar residues: 4 Hydrophobic residues: 1
Hydrophobicity: -58 Boman Index: -201
Half-Life / Aliphatic Index: 4.4 hour Aliphatic Index: 20
Instability Index: 5736 Extinction Coefficient cystines: 4470
Absorbance 280nm: 1117.5

Literature

  • PubMed ID:  2832414
  • Title:  The rat gene encoding neurotensin and neuromedin N. Structure, tissue-specific expression, and evolution of exon sequences.
  • PubMed ID:  8471039
  • Title:  Immunological and biochemical characterization of processing products from the neurotensin/neuromedin N precursor in the rat medul
  • PubMed ID:  8462460
  • Title: